PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00305.1.p
Common NameEUGRSUZ_I00305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 274aa    MW: 30458.5 Da    PI: 9.7055
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00305.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.1e-31190245156
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES-- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeH 56 
                       ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H
  Eucgr.I00305.1.p 190 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRH 245
                       59****************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-32175246IPR003657WRKY domain
SuperFamilySSF1182901.31E-27182246IPR003657WRKY domain
PROSITE profilePS5081128.277185245IPR003657WRKY domain
SMARTSM007746.4E-34190249IPR003657WRKY domain
PfamPF031062.4E-24191245IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSTTATSTQG MLSQAAAPTM LEDQNLPSQL GFYSIFPSSM GSLASCSSSL CFNQTLKSLF  60
TLPSSLVSPD PPSNSNNNNL TLITETLLSS TAPHKQRENL QTPSELLGGP QLLSLQRSTP  120
NLWAWGELSD QSSLVMRSSS GGGDHGDHYR DHHHHQSMGV SALKMKKIKG RRKVREPRFC  180
FKTMSDVDVL DDGYKWRKYG QKVVKNTQHP RSYYRCTQDN CRVKKRVERL AEDPRMVITT  240
YEGRHVAGRR GLTGLLAAER LLLVDTDHTY ISI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-26181245872Probable WRKY transcription factor 4
2lex_A6e-26181245872Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00305.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027754.10.0PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 13
SwissprotQ9SVB72e-58WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A059AKP80.0A0A059AKP8_EUCGR; Uncharacterized protein
STRINGVIT_07s0031g01840.t012e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-55WRKY DNA-binding protein 13